Skip to content

OpenProteinAI/PoET-2

Repository files navigation

PoET-2

This repository contains inference code for PoET-2, a multimodal, retrieval-augmented protein language model for state-of-the-art variant effect prediction and controllable protein sequence generation.

Environment Setup

  1. Be on a Linux machine with a NVIDIA GPU.

  2. Install pixi, a package management tool.

  3. Install the Python environment by running pixi install at the root of this repository.

    • To run a script using the Python environment, run pixi run --no-lockfile-update python path/to/script.py
    • NOTE: The environment comes with a custom implementation of FlashAttention that overrides the behavior of the alibi_slopes parameter. Therefore, other models that make use of FlashAttention's alibi_slopes parameter may not work properly.
  4. Run make download_model to download the model weights (~400MB). The model weights will be located at data/gitignore/models/poet-2.ckpt. Please note the license.

Examples

Zero-shot variant effect prediction

Use the script scripts/score.py to predict the functional effects of protein variants. It scores variants by ensembling predictions across different prompting strategies that leverage PoET-2's multimodality.

These strategies include using prompts with and without predicted structures for homologs, and optionally conditioning on the wild-type structure via an "inverse-folding" query. For more details, see the paper.

Primary Input Arguments

  • --checkpoint: Path to the PoET-2 model checkpoint file. This defaults to data/gitignore/models/poet-2.ckpt, which is the location where the model is placed after running make download_model.
  • --wt_sequence: The amino acid sequence of the wild-type (WT) protein. If provided, the script will report scores as log-likelihood ratios relative to the WT. Otherwise, the script will report raw log-likelihoods.
  • --msa_a3m_path: Path to a multiple sequence alignment (MSA) of homologs for the WT protein in A3M format. The model uses this MSA to construct the prompt context.
  • --wt_structure_path: Path to the WT protein's structure file (e.g. PDB or CIF).
  • --variants_fasta_path: Path to a FASTA file containing all the variant sequences to be scored.
  • --output_npy_path: The path where the final scores will be saved as a NumPy array (.npy file).
  • --AF2_cache_folder: A directory to cache protein structures downloaded from the AlphaFold DB; see the following section for more information. Defaults to data/gitignore/cache/AF2.

Structure Downloading and MSA Header Format

The script automatically downloads structures from the AlphaFold DB using UniProt accession IDs extracted from the sequence headers in the MSA. For this to work, the UniProt ID must be the last part of an underscore-separated string in the header (e.g. from >UniRef90_A0A1B2C3D4, it extracts A0A1B2C3D4). Any text following a tab character is ignored. This format is compatible with standard MSA generation tools like ColabFold MMseqs2.

Downloaded structures are saved to the --AF2_cache_folder to avoid re-downloading them on subsequent runs.

Example Usage

To use the scoring script to score all variants in the BLAT_ECOLX_Jacquier_2013 dataset from ProteinGym, we can run the following command:

pixi run --no-lockfile-update python scripts/score.py \
    --wt_sequence 'MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW' \
    --msa_a3m_path 'data/BLAT_ECOLX_ColabFold_2202.a3m' \
    --wt_structure_path 'data/BLAT_ECOLX.pdb' \
    --variants_fasta_path 'data/BLAT_ECOLX_Jacquier_2013_variants.fasta' \
    --output_npy_path 'data/gitignore/outputs/BLAT_ECOLX_Jacquier_2013_variants.npy'

This command uses the provided MSA and WT structure to score all sequences in the variants FASTA file. The output scores will be saved as a NumPy array to the specified output path. The resulting scores should have a Spearman correlation of ~0.7 with the experimental fitness values, which can be found in the DMS_score column of data/BLAT_ECOLX_Jacquier_2013.csv.

Additional Flags

Downloading structures for all proteins in the prompt context can be time-consuming. If you want to prepare the prompts without running the full GPU-based scoring pipeline, you can use the --sample_prompts_only flag. This will perform all non-GPU steps, including sampling MSA contexts and fetching structures, and then exit. This can be useful for debugging or pre-processing on a machine without a GPU.

License

The following table lists the licenses for the components of this project. Please review the terms for each component carefully.

Component License
Source Code
(excludes model weights)
Apache License 2.0
Model Weights PoET Non-Commercial License Agreement

For commercial use of the model weights, please reach out to us at contact@ne47.bio.

Third-Party Components

This repository includes artifacts from third-party projects:

  • Code in src/poet_2/models/modules/norm.py is adapted from Mamba and originally licensed under the Apache License, Version 2.0.
  • Code in src/poet_2/models/modules/glu.py for the class GLU is adapted from x-formers and originally licensed under the MIT License.
  • Code in src/poet_2/models/poet_2.py (specifically the decode function) is adapted from FlashAttention and originally licensed under the BSD 3-Clause License.
  • Code in src/poet_2/models/modules/packed_sequence.py (specifically unpad_input and pad_input) is adapted from FlashAttention and originally licensed under the BSD 3-Clause License.
  • Code in src/poet_2/models/modules/attention_flash_fused_bias.py is adapted from TurboT5 and originally licensed under the Apache License, Version 2.0.
  • Some code in this repository depends on a custom implementation of FlashAttention; FlashAttention is originally licensed under the BSD 3-Clause License. This custom implementation overrides the default behavior of the alibi_slopes parameter of the attention function.

Copies of the applicable third-party licenses are available in the third_party_licenses/ directory.

Portions of the aforementioned artifacts that the original licenses require to remain under those licenses continue to be governed by them; all other poritions of the aforementioned artifacts, and the rest of the repository, is covered by this repository’s license(s).

Citation

You may cite the paper as

@misc{truong2025understandingproteinfunctionmultimodal,
      title={Understanding protein function with a multimodal retrieval-augmented foundation model}, 
      author={Timothy Fei Truong Jr and Tristan Bepler},
      year={2025},
      eprint={2508.04724},
      archivePrefix={arXiv},
      primaryClass={q-bio.QM},
      url={https://arxiv.org/abs/2508.04724}, 
}

About

Code and model weights for PoET-2, a retrieval-augmented multimodel protein language model for protein sequence generation and representation learning

Topics

Resources

License

Stars

Watchers

Forks

Releases

No releases published

Packages